PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004419.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 2305aa    MW: 257823 Da    PI: 8.3873
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004419.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.92.4e-16770818150
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50 
                              lp+GfrF Ptdeel+++yLk k++g+k e+ +vi+++di+k+ePwdLp  
  Itr_sc004419.1_g00003.1 770 LPVGFRFYPTDEELINHYLKLKINGSKAEV-NVIRKIDICKLEPWDLPVV 818
                              79*************************999.99**************942 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF139762.2E-9246308IPR025724GAG-pre-integrase domain
PROSITE profilePS5099417.266310483IPR001584Integrase, catalytic core
Gene3DG3DSA:3.30.420.101.5E-23317470IPR012337Ribonuclease H-like domain
PfamPF006651.1E-16323434IPR001584Integrase, catalytic core
SuperFamilySSF530981.64E-35324492IPR012337Ribonuclease H-like domain
SuperFamilySSF1019411.7E-17761835IPR003441NAC domain
PROSITE profilePS5100517.85770954IPR003441NAC domain
PfamPF023658.6E-6771813IPR003441NAC domain
CDDcd003031.41E-910861173No hitNo description
SuperFamilySSF566724.89E-8112521571No hitNo description
Gene3DG3DSA:3.10.10.103.2E-1912591387No hitNo description
CDDcd016471.45E-5912921448No hitNo description
PfamPF000783.7E-1713091448IPR000477Reverse transcriptase domain
Gene3DG3DSA:3.30.70.2704.1E-413881452No hitNo description
PROSITE profilePS5087912.57915981727IPR002156Ribonuclease H domain
SuperFamilySSF530987.46E-1915991722IPR012337Ribonuclease H-like domain
CDDcd092791.32E-3716021724No hitNo description
Gene3DG3DSA:3.30.420.108.2E-816071729IPR012337Ribonuclease H-like domain
PfamPF134566.0E-2116091724No hitNo description
PROSITE profilePS5099421.00518552010IPR001584Integrase, catalytic core
SuperFamilySSF530984.3E-3918572004IPR012337Ribonuclease H-like domain
PfamPF006659.4E-1818591966IPR001584Integrase, catalytic core
Gene3DG3DSA:3.30.420.107.9E-3918592014IPR012337Ribonuclease H-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0003677Molecular FunctionDNA binding
GO:0004523Molecular FunctionRNA-DNA hybrid ribonuclease activity
Sequence ? help Back to Top
Protein Sequence    Length: 2305 aa     Download sequence    Send to blast
MVLQEETIHS AKVSEDKSPE VMSFAVKTGS GKGRGRFHKL DKSHLLCTHC KKSGHDVSQC  60
FEIHGYPEWY ENRGNNARGG HSGRGRGVPR ANATLTNKFT DKCGVSSSHL FSADQWKALT  120
RLISGTKVSD DQLNGKFDTR LWIIDIGASR HVTGDSTRMT NAKDIFHCPV GLPNGKTMVA  180
TQEGSVRLTD KITLNHVLYI PSLSCNLISV SQLNDDMQSS VHFNSYMCAI QDQSREMIGT  240
GFRRYGLYYY NETDSVQHLI VNGVTTSVDL WHQRMGHPSE KVMKLLPSVS IGARSFDKAC  300
EVCFRAKQPR EKFPLSNNRA SRIFEKIHCD LWGPYRHQSF CGARYFLTTI DDYSRAVWIY  360
LLIDKTEVLK MFLSFVAMID RQFSQSIKVV QSDNGAEFKC LRDFFSATGI LFQTSCVGTP  420
QQNGRVERKH KHILNVVRAL RFQAKLPIYF WGECVLAAAH LINRTPTPLL DNKTSYEILF  480
GSPPSYNTIR VFGCFAHNQK AKDDFPFPLT DTTAMSHEEF VHEDFSVILE EAEPSSTNEP  540
NPQPEPSSTP EPTSQPESNL TPEFNSQTEH HTSNLVPNNQ DQNVEMGRGM RNKVPSVWLR  600
DYVINSTVAK SPSSVTPSPQ SSSECWVTPP NSLEEVGGAR MLGWMKVEFV HDFKDSAVCP  660
SMEDSLKEYE ENSSCMPIYS HKYSNNGLAA KMVRVKEANS EGQCRGVGEA VGGDGPVGKS  720
GRSGSVEARA WAVRGSIREK KRSKPERRNV VLAVLLLERS TTVLLPLSSL PVGFRFYPTD  780
EELINHYLKL KINGSKAEVN VIRKIDICKL EPWDLPVVAD SVDMLGSKER CFVGPGWGPW  840
GFGIQPFGRR ENNGPRSPSA EHLSRSLEED GRPRGGRRSQ RCQAPVGDRR TRSERCKTTA  900
RSQKEGSGWE SDLHSLIKPI GEILEYAQSC NMIQLSAPAR DGLDKDKYCA YYRNRGHETD  960
ECHVLKGLIE DLLRSGELAQ FAAEKKKNRR RGWKKYFKRS DKEKKDKGPE PDHDPPAAGS  1020
KQIIHVIFGG LEGGDNSEPR RAWSRDLPVC SISTSQPEKR MKDEPITVTD RDLPLGGEQS  1080
AEALGITVNI CGAKVRRVMV DTGSSVNVLY LEAFQKLKIE RSALTPVRTP LSGFTGDMVH  1140
PEGMVVLSVE VGVYPKILKV EMEFIIVNLA CFPTLEGVGT VRGDPRSARL CYVRAVEKQA  1200
ASTSRVNTIA RRKDEEKKEQ PGPSEPGEEV PLEVRRHFSL GPEDMPGIDR DVICHWLSVS  1260
PTSNPVKQKQ RHLSVDQHEF VKGEVKALLS AGHIREVTYP EWVANVVLVP KPPAWRMCID  1320
HTDLNRACPL DPYPLPSIHQ MVDETAGAEL MSFMDAFKGY HQIMMAEADE EKTTFVTPGG  1380
LYCYRVMPFG LRNAGATYQR IINSVFGRLL GRSMEAYIDD MLVKSTIRVD HPCHLRACFQ  1440
VMREHRLRRG IESNLADRAH PFFKILKKSN GFTWDEDSRA AFEDLKAYLA SPIVLSKPEP  1500
GEDLEVYLVV SDRAVSAVLC RVDHEGVQRP VYYVSHALQG PEFRTSTSSG RLVKWAMMLT  1560
QFALEYKPRS SIKAQALADF MVECTARDTE ADQNSPHTPE WWEVSTDRSS GKKGAGAGIV  1620
ITTPEGFKAF YDILLRFLPT NNEAEYEALI TGLQRARQLG VKTIQVKTDS ALVVGQVNGE  1680
FVTNGDKLMI YKDRVLTVLR KFEAHELTHI PRSDNADADT LSQLVHEAPE HISKIAHIEE  1740
AVAPCIDSFE VEPVGVEQDS WITDLKEYLQ DGKMLEEEDR TRKVRLRVPR FQIVGDRLYR  1800
RSYGGPLMRC LNAFEANIVI KELHSGLCSA HQGGRSLARR IMIPGRPATF YQPISTAIPF  1860
ARWEVDIIGP FPMLAARKKF VIVAIDYFSK WIEAEPLAKQ CARFVWRNVI ARFGVPVHLI  1920
SDNGRQFESQ YFQNFLALIG AKSIRSSVAY PQGNGQVENA NRTILDGLKK KLFDAGRSWA  1980
DELPYVLWAY RTTPREATKE TPFALVYGAE ARLPFEAWIP TSGERGYDEA NNERMMIAEL  2040
DAVEERREVV ARRIVEYQGK IKQSCDLRVR PRYFQADGSK VPISGVKCSI TLVCRPYGPR  2100
GRWEQGAHLG SKADGSKVPI SGVRCPITLV CRPYGRWEQG AHVGSKGFRC SVDGGTSSAR  2160
SKILQNLPTG RSFRRTWLGV RPWAGVGHFA REQIQHSWEI SLLEALSQGR VNLLLYGSAT  2220
RGKGPLPIDP CELIPDLRVN EGGEELLGYG LIGANKPSKA AGVLHLVNSL LLGLLCPLNS  2280
ALDFTEFLLG FSARSSAAAS SFSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ol8_A7e-251234144735243Reverse transcriptase/ribonuclease H
4ol8_B7e-251234144735243Reverse transcriptase/ribonuclease H
4ol8_E7e-251234144735243Reverse transcriptase/ribonuclease H
4ol8_F7e-251234144735243Reverse transcriptase/ribonuclease H
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.31e-15NAC transcription factor-like 9